SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000933 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000933
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.66e-117
Family Transglutaminase core 0.0000000000201
Further Details:      
 
Domain Number 2 Region: 9-191
Classification Level Classification E-value
Superfamily E set domains 2.13e-56
Family Transglutaminase N-terminal domain 0.000000017
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.37e-33
Family Transglutaminase, two C-terminal domains 0.00000218
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.11e-27
Family Transglutaminase, two C-terminal domains 0.00000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000933   Gene: ENSOGAG00000001042   Transcript: ENSOGAT00000001044
Sequence length 732
Comment pep:known_by_projection scaffold:OtoGar3:GL873545.1:3163639:3313214:-1 gene:ENSOGAG00000001042 transcript:ENSOGAT00000001044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSTATFGGRRAVPPNNSNAEEDDLPTVELQGLTPRGFNPEDYLNVTSVHLFKERWDS
NKIDHHTDKYDNSNLIVRRGQSFYVQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVPELQSGKWGAKVVMREDRSVRLSIQSSPECIVGKFRMYVAVWTPYGILRTRRNPETD
TYILFNPWCEEDAVYLDNEKEREEYVLNDIGVIFYGDVNDTKSRSWSYGQFEDGILDACL
YVMDRAQMDLSGRGNPIKVSRVGSAMINAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
SEYKSSANPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQLDIFLEENGK
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVETVDATHIGKLIVTKEIEGDGMKDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVVKSRSDVDMDFEVENAVLGKDFKLTITF
QNNSPNRYTISAYLSGNIVFYTGVSKEEFKKETFTVTLQPLSFKKEEVPILAGEYMGQLL
EQASLHFFVTARINETKDVLAKQKTTVLTIPTVVIKVRGAKVVGSEMVVTVEFTNPLKET
LQNVWLYLDGPGILRPRRRMFREIRPNTTVQWEEVCRPWVSGPRKLIASMTSDTLRHVYG
ELDLHIQRRPSV
Download sequence
Identical sequences H0WHR6
ENSOGAP00000000933 XP_012659666.1.62490 ENSOGAP00000000933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]