SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000990 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000990
Domain Number 1 Region: 486-718
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1487-1737
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-32
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 3 Region: 1162-1324,1361-1438
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 101-257,299-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-31
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000990   Gene: ENSOGAG00000001113   Transcript: ENSOGAT00000001114
Sequence length 2323
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:12007194:12330691:-1 gene:ENSOGAG00000001113 transcript:ENSOGAT00000001114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPYPFLPTITPLSPWEYMILATIIANCIVLALE
QHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVL
SGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLF
FAILMFAIIGLEFYSGKLHRACFTNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGI
TQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGV
LSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNTGTSALEV
LRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSSKVDGASYFRHKERLLRISV
RHMVKSQVFYWVVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYG
MGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKVTKYWASL
RNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMT
VFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANA
QELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSMWEPRSSHLRER
RRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRR
PRAIEGLALGLGLEKCEEERISRGGSLKGDGGDLSSTLDNQRSPLSLGRREPPWLSRPCH
GNCDPTQQEAGGGEATVTFEDRARHRQSQRRSRHRRVRTEGKESASASRSRSVSQERSLD
EAGPADAEKDHEPRGSHGGKEPTIQEERAQDLRRTNSLMVARGCGLAGALEEADTHPGLP
HSELDARKGTALTEEPEGSSEQALLGDVQLDMGRAVSQSEPDLSCITAGKDKATTESTSV
AVSIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEDEEEVEKKKQKKEKRETGKAMVPH
SSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNRVLRYFD
YVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALAAALLTNKGRD
IKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQL
FKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVST
GEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQG
DKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIAL
NTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITV
IGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIML
SCLGEKGCEPDTTAPSGQSENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLT
RDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRL
VLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKM
LDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQE
IIANAKALPYLQQDSVSGLSGRSGYPSMSPLSPQEIFQLACMDPTDDGQFQEQQSLEPEV
SELKSVQPSNHGIYLPPDTQEHAGSGRASSMPRLTVDPQVMTDPSSMRRSFSTIRDKRSN
SSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDAHRSGGRERGRSKERK
HLLSPDVSRCNSEERGTQADWESPERQQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTS
TPRRSRRQLPPVPPKPRPLLSYSSLMRHAGSISPPADGSEGGSPLTSQVLESHSACLTES
SNSPHPQQGQQPSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAP
PLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
Download sequence
Identical sequences H0WHW8
ENSOGAP00000000990 ENSOGAP00000000990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]