SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001012 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001012
Domain Number 1 Region: 171-199,233-430
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-56
Family Voltage-gated potassium channels 0.0008
Further Details:      
 
Domain Number 2 Region: 45-139
Classification Level Classification E-value
Superfamily POZ domain 1.28e-24
Family Tetramerization domain of potassium channels 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001012   Gene: ENSOGAG00000001135   Transcript: ENSOGAT00000001136
Sequence length 488
Comment pep:known_by_projection scaffold:OtoGar3:GL873730.1:1585200:1588214:1 gene:ENSOGAG00000001135 transcript:ENSOGAT00000001136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLRADTGHRAGSAAAASGPDARSRVAGAARAMEPRCPPPCGCCERLVLNVAGLRFETRA
RTLGRFPDTLLGDPTRRSRFYDEVRREYFFDRHRPSFDAVLYYYQSGGRLRRPAHVPLDV
FLDEVSFYGLGAAALARLREDEGCPVPPERPLPRRAFARQLWLLFEFPESSQAARVLAVV
SVLVILVSIVVFCLETLPDFRDDRDDAGIAAVAAAAPFPTRLNGSSPAPGNPPRLPFSDP
FFMVETLCICWFSFELLVRLMACPSKAIFFKNVMNLIDFVAILPYFVALGTELARQRGVG
QPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFSS
AVYFAEVDRVDSHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISL
PVPVIVSNFSYFYHRETEGEEAGMFSHVDTQPCGTLEGKANGGLVDGEMPELPPPLWAPP
AKHLVTEV
Download sequence
Identical sequences H0WHY5
ENSOGAP00000001012 ENSOGAP00000001012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]