SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001045 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001045
Domain Number 1 Region: 191-251
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001045   Gene: ENSOGAG00000001168   Transcript: ENSOGAT00000001169
Sequence length 421
Comment pep:novel scaffold:OtoGar3:GL873686.1:186384:222498:1 gene:ENSOGAG00000001168 transcript:ENSOGAT00000001169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIIWCYCSLLFQAKIDLLLVGDVTVPYLANAVQEVFSNIEVTVTTSDVKKAAVLLDDCI
FHMVFLKMTSLSAEELEAVKLIRFGKKKNIHLLFVFIIPENFKGCISGHGADIILTEPLT
VEKMTIVAKYWKTYFSNTVKKENTISIEEPGLLLQRSCSEPLEYFSTDLFACPESLRNDN
GLELNPPLSESEKSKKISLLHSSKEKLRRERIKYCCEQLRILLPYVKGRKNDSASVLEAT
VDYVKCVREKIPVAVMDQITEALRSNRRFCKKQQMPIQLPLPGAVGAQRENNVLTSTYSP
VRGIQFLANKCFNVYSVPAAGGSLDEAVRGQSASTSENTVGDLYKTRTSSTALSLNSFRA
VTYYSKVIPSYDAATITNQNISIHLPSAVPKVSKFLPHHCNSVLGQTRTTHPNCLQQFWA
Y
Download sequence
Identical sequences H0WI13
ENSOGAP00000001045 ENSOGAP00000001045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]