SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001053 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001053
Domain Number 1 Region: 262-478
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.49e-31
Family Nuclease 0.086
Further Details:      
 
Domain Number 2 Region: 62-258
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.63e-31
Family Nuclease 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001053   Gene: ENSOGAG00000001175   Transcript: ENSOGAT00000001177
Sequence length 490
Comment pep:known_by_projection scaffold:OtoGar3:GL873752.1:889711:899954:-1 gene:ENSOGAG00000001175 transcript:ENSOGAT00000001177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPKLMYQELKVPVEEPTNELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLW
EYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSL
DIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVKVRIAVSKPNGPQPQANLQAL
LQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCL
ARDLTKIFEAYWFLGQAGSSIPSTWPRPYDTRYNQETPMEICLNGTPALAYLASAPPPLC
PSGRTPDLKALLNVVDNARSFIYIAVMNYLPTMEFSHPRRFWPAVDDGLRRATYERGVKV
RLLISCWGHSDPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM
VTERGTYFGTSNWSGSYFTETAGTSLLVTQNGRGGLRSQLEAVFLRDWDSPYSHDLDTSA
DSVGNACRLL
Download sequence
Identical sequences H0WI20
ENSOGAP00000001053 XP_003802160.1.62490 XP_012668388.1.62490 XP_012668389.1.62490 XP_012668390.1.62490 ENSOGAP00000001053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]