SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001139 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001139
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-32
Family DBL homology domain (DH-domain) 0.00069
Further Details:      
 
Domain Number 2 Region: 219-356
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-24
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001139   Gene: ENSOGAG00000001272   Transcript: ENSOGAT00000001275
Sequence length 378
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:27001180:27027327:-1 gene:ENSOGAG00000001272 transcript:ENSOGAT00000001275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFMNTLKYLQMHEFLLDVDLWRLFANLEELAQTSLGFVNSLFRLIRDYVDASETLPSMDF
ISVLTKYFRGSLCQSHQTYCLNYSATVFYLDSLRQRDDFGIYLKWCEQNEQCRRLHLPEL
LVAPLHRLTRYPLLLKNIWKRSTDPAEKVMIYSIKERVDRSIRDLEGKVKWLDNFQKFRQ
LQEIIVWPPLWDRDKRFFIPEGLKHIFKEHMAENILSPTNRHLLYEGKLTLAESTRFLDV
YLFLFDDFLLVTKTKRNKKKVGGSDASLMCPSLTPELQTVIKEGGSCTVLDQPIPLDRLV
VKSIDPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMVQITTAISCFIKS
QETKKISLFTLPAESSEI
Download sequence
Identical sequences H0WI95
ENSOGAP00000001139 ENSOGAP00000001139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]