SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001154 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001154
Domain Number 1 Region: 56-162
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 325-424
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 434-550
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 4 Region: 202-303
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001154   Gene: ENSOGAG00000001292   Transcript: ENSOGAT00000001293
Sequence length 774
Comment pep:known_by_projection scaffold:OtoGar3:GL873593.1:6015186:6070064:1 gene:ENSOGAG00000001292 transcript:ENSOGAT00000001293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLQGTCLCLCVAVLALLPSPSLAQYDSWPYYPEYFQQPAPEYQQPRVPADVAKVQLRL
TGQKRKHNEGRVEVYYSGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNVYCTGKEATLAACSSNGWGVTDCKHTEDVGVVCSEKRIPGFKFDNSLVNQIENLN
IQVEDIRIRAILSTFRKRTPVTEGYVEVKDGKHWKQICDKHWTAKNSRVVCGMFGFPGEK
AYNTKVYKIFASRKKQRYWPYSMDCMGTEAHISSCKLGPPVSLDPMKNVTCENGLPAVVS
CMPGQVFSPDGPSRFRKAYKPEQPLVRLRGGANIGEGRVEVLKNGEWGTVCDDKWDLLSA
SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIECTGNEKSLIDCKFNAESQGCNHEEDA
AVRCNIPAMGFQKKLRLNGGRNPYEGRVEVLVERNGSLVWGTVCGENWGIVEAMVVCRQL
GLGFASNAFQETWYWHGDIFANKVVMSGVKCSGTELSLAHCRHDEEDVACPQGGVQYGAG
VACSETAPDLVLNAETVQQTTYLEDRPMFMLQCAMEENCLSASAVNTDRTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKSYECANFGEQGITMGCWDMYRHDIDCQWIDITDVPPGEYLFQVVINPNYEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSLSEETEKKFEQFSGLLNNQLSPR
Download sequence
Identical sequences H0WIA9
ENSOGAP00000001154 ENSOGAP00000001154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]