SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001156 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001156
Domain Number 1 Region: 26-142
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 2.59e-21
Family CSE2-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001156   Gene: ENSOGAG00000001294   Transcript: ENSOGAT00000001295
Sequence length 146
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:277067:288713:1 gene:ENSOGAG00000001294 transcript:ENSOGAT00000001295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGVAAGRQAEDALPPSSEPPPDTKSLPPPQPPPPVAAPQPQQSPAPRPQSPALVREE
ENYSFLPLVHNIIKCMDKDSPDIHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQLLLHS
LREQVRTKNELLQKYKSLCMFEIPKE
Download sequence
Identical sequences H0WIB1
ENSOGAP00000001156 XP_003791077.1.62490 ENSOGAP00000001156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]