SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001218 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001218
Domain Number 1 Region: 673-778
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 184-575
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 2.09e-34
Family Soluble quinoprotein glucose dehydrogenase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001218   Gene: ENSOGAG00000001369   Transcript: ENSOGAT00000001370
Sequence length 782
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:25456929:25482564:1 gene:ENSOGAG00000001369 transcript:ENSOGAT00000001370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALLALRALLALRALRAAAHPQCLDFRPPFRPPQPLRFCAQYSAFGCCDPEQDATLARRF
GTLAARVDAAMWAKCAGYALDLLCQECSPYAAHLYDAEDPSTPLRTVPGLCQDYCLDMWQ
TCRGLFRHLSPDHMLWALEGNRAKFCHYLSLDDKDYCFPHLLVNENLNLNLGRVTADAKG
CLQLCLEEVANGLRNPVAMVHARDGTHRFFVAEQVGLVWAYLPDRSRLEKPFLNISRAVL
TSPWEGDERGFLGIAFHPRFRHNRKLYIYYSVAVSFDEWIRISEFRVSEDDENTVDHGSE
RIILEIEEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGKFGNAQNKSALLGKVLRID
VDRNERGPLYHIPPDNPFVGDPAARPEVYALGVRNMWRCSFDRGDPVSGAGRGRLFCGDV
GQNKFEEVDLVERGRNYGWRAREGFECYDRKLCANASLDDVLPIFAYPHKMGKSVTGGYV
YRGCEYPNLNGLYIFGDFMSGRLMSLREKPGTGQWQYSEICMGRGQTCAFPGLINNYYPH
IISFAEDEAGELYFMSTGVPSATAARGVVYKVIDPSRRAPPGKCQIHPAQVKVKSRLVHF
VPKEKFIRRMESTPRPTMRTATKAPRRSRPTEAPRTQTSRPARPTRRPGGRRGSGRRRGR
PSTAGPAPSNGVVRLVRPAGLSPGRGRVEVFVGGRWGTVCDDAWDVKAAAVVCRQLGFAH
AVRASKRAEFGEGRSLPILLDDVRCAGSEHSLLECTHAGVGTHNCGHQEDAGVVCSHEDP
DL
Download sequence
Identical sequences H0WIF9
ENSOGAP00000001218 ENSOGAP00000001218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]