SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001244 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001244
Domain Number 1 Region: 27-103
Classification Level Classification E-value
Superfamily F-box domain 0.000000000366
Family F-box domain 0.0095
Further Details:      
 
Domain Number 2 Region: 139-160,190-314,344-352,379-460
Classification Level Classification E-value
Superfamily RNI-like 0.00000181
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001244   Gene: ENSOGAG00000001396   Transcript: ENSOGAT00000001398
Sequence length 1186
Comment pep:known_by_projection scaffold:OtoGar3:GL873522.1:27410990:27574455:-1 gene:ENSOGAG00000001396 transcript:ENSOGAT00000001398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRKKSVKTCLMNNEIPEETTSDETKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKL
KEAVTLYLRVVRVVDLCAGRWWEYMPCGFTDSSFLTLLKKMPDVEQLYGLHPRYLERRRV
RGHEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPE
NKLKIPIGAKIQTLHLVGNSVVKAPAICMGAGGYNSPVVLKNPHGISILHCSSKDLFFFL
GPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQHVVEDSWRSGGFRNLHTIVLGAC
KNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVDEFLL
QSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWISDH
SRWTRLVDINLVRCHALKLDSFGQFIELLPSLEFISLDQMFREPPKGCARVGLSAGTGIG
VSSALVSNQNSNNDNDNNAQNNNANLHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALN
EMEDMVQEDGEVVAESGNNTPAHSQAIVPVDVDEEQAGPSGLQRVVKPTPITVHDSESDD
EEDSLELQEVWIPKNGTRRYSEREEKNGESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQ
FPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDVYPSCSSTTASTVGNSSSHSTAS
QSPDFVRTVNSSGSSEPSPTEVDVSRQCVCSPDGSEDSEAMEEGDAESSVCPRCCCHRPQ
ESQRRTSRCSDEERPSTSRACVVNGPDGTRSAFSFRTLPQGGSSGPAHDERTNGSGSGAT
GEDRRGSSQPESCDEQCNEDYPRRPLTRARSRLSHVPLVSESEVAKTKSRHAMKRKRTAD
KSTSTSDPVIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHL
KVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGP
YPYHICIIHEFSNPPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRSEEDLKKYPKYP
WGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLS
ADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI
Download sequence
Identical sequences H0WII1
ENSOGAP00000001244 ENSOGAP00000001244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]