SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001264 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001264
Domain Number 1 Region: 91-207
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000455
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001264   Gene: ENSOGAG00000001419   Transcript: ENSOGAT00000001420
Sequence length 266
Comment pep:known_by_projection scaffold:OtoGar3:GL873618.1:1105353:1116423:1 gene:ENSOGAG00000001419 transcript:ENSOGAT00000001420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAVTRRAKVASGQRMSKFLKHFTVVGDDYQAWNINYKKWENEEEEDEEDQQLPPTPASDE
EGQASGPATAPVPAPRPPLDFRSKLRKLFSSHRFQVIIICLVILDALLVLAELILDLKII
QPDKNNYAPWVFHYLSIVILAFFMMELFFKIFVFRLEFLYHKFEILDAIVVVVSFILDIV
LLFREHEFEALGLLILLRLWRVARIINGIIISVKTRSERQLLKLKQMNIQLAAKIQHLEF
SCSEKEQEIERLNKLLRQHGLLGEVN
Download sequence
Identical sequences H0WIJ8
ENSOGAP00000001264 ENSOGAP00000001264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]