SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001317 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001317
Domain Number 1 Region: 227-302
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000637
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001317
Domain Number - Region: 293-333
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0182
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001317   Gene: ENSOGAG00000001476   Transcript: ENSOGAT00000001478
Sequence length 346
Comment pep:known_by_projection scaffold:OtoGar3:GL873619.1:5204911:5214081:1 gene:ENSOGAG00000001476 transcript:ENSOGAT00000001478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DSNIQYQFRTETNGGQVTYRVVQVTDGPLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD
GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA
VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH
NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLELVGESARQ
Download sequence
Identical sequences H0WIP4
ENSOGAP00000001317 ENSOGAP00000001317 XP_003796143.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]