SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001416 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001416
Domain Number 1 Region: 777-980
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.3e-47
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 1014-1210
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-45
Family BAR domain 0.002
Further Details:      
 
Domain Number 3 Region: 1510-1575
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-18
Family SH3-domain 0.0000211
Further Details:      
 
Domain Number 4 Region: 243-305
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00091
Further Details:      
 
Domain Number 5 Region: 1279-1356
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-16
Family SH3-domain 0.00000659
Further Details:      
 
Domain Number 6 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000368
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 7 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000893
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 68-135
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000184
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001416   Gene: ENSOGAG00000001589   Transcript: ENSOGAT00000001592
Sequence length 1578
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:20669098:20749647:1 gene:ENSOGAG00000001589 transcript:ENSOGAT00000001592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
LPSLKEGERLFVCICEFTSQELNSLPLHRGDLVILDGTPTGGWLQGRSCWGARGFFPSSC
VRELCLSSQSQQWHSQSALLEIPEYSMGQARALMGLSAQLDEELDFREGDVITIVGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSAGNQDDGLVNGEVDIPIEEEERGPEDD
EEPGTYGIALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRIGIFPYRFVKLCP
DPRMQENMVLPQEGNLAKIPETSLDCLKDSLVVEKQRHESCEYDTEESTYVISETSTSPL
GHLTSENEANKNSHQDEGISGGPPRSPGMEQETPLAKDSAMTDPLEVVNGVSSQTYVPFH
PRLQKSQSSSTVGRGHLHSEQYDFLPLETRTRDYSSLPPRRTYSQLNTLQRPATPLHRGS
LLSASRMMKPSPWIPQLQSLAKYAKKHHAPKENTSTFYFTSEGSERKPALQGKGLAMEAT
TLSQGDGILDLDSKLTQQLIEFEKSLAGPGIEPEKILRHFSIMDFNSEKDIVRGSSRLIT
QQEPPERRKALRPPPPRPCTPASPPHLLVEQNVRPVLPLAVRPSRPAPLPPSAQQRMNAV
SPNLLSRHRPSCEALEKEGPGHMEKSLDQSSPCPLVLVKIQEMEKDLDMYNQAQEELNLL
LEEKQDESVRAETLENLKFCENNIESLNMELQQLREMTLLSSQSSSLVASPGSMSTENPE
QRMLEKRAKVVEELLQTERDYIRDLEMCIERIMVPLQQAQVPNIDFEGLFGNMQMVIKVS
KQLLAALEISDAVGPVFLDHRDELEGTYKVYCQNHDEAISLLEIYEKDEKIQKHLQDSLA
DLKTLYSEWGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAVK
EINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQI
KDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVCMERGHRDLE
QFEKVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERA
EKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQGLFTSCVHGYAEAHCDFVHQAL
EQLKPLLSLLKEAGREGNLIAIFHEEHSRVLQQLQVFTFFPEALPATRKPFERKTVDRQS
ARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKK
DPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFLRQN
SNNTLTFNPSSMAVSFTSGPCQKQPQDASSLKEYDQDALSASVNLGNSESDPSRCPSEPD
GTSQPTPGDSAHPARDINPLAATLQSYRNSRHPEMVGYSIPGRNGQGKDLIKECARTAQA
LEDKKEEPANSEPEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVMGNTEWWLAEV
NGKKGYVPSNYIRKAEYT
Download sequence
Identical sequences H0WIX9
XP_003787317.1.62490 ENSOGAP00000001416 ENSOGAP00000001416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]