SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001464 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001464
Domain Number 1 Region: 130-308
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.98e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0041
Further Details:      
 
Domain Number 2 Region: 82-126
Classification Level Classification E-value
Superfamily TGS-like 0.0000301
Family TGS domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001464   Gene: ENSOGAG00000001642   Transcript: ENSOGAT00000001643
Sequence length 334
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:11279498:11302005:1 gene:ENSOGAG00000001642 transcript:ENSOGAT00000001643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARARGLRLWRVAGGGAGLRFIATSPASHLSLTELTEMRNDLFNKEKKRQLSLTPRTEK
IEVKHVGKTDPGTIFVMNKNISTPYSCAMHLSEWYCKKSILALVDGEPWDMYKPLTKSCE
IQFLTFKDRDPREVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFCYDVV
LDKRLDEWMPTKENLRSFTKDARTLIYKDLPFETLDVDAKVALEIFQHNKYKIDFIEEKA
SQNPERTVKLHRIGDFIDVSEGALIPRTSICFQYEVSAVHNLQPAPPSLLRRFQGLSLPV
HLRAHFTIWDKLLERSRKMVTEDQTKPTEESAST
Download sequence
Identical sequences H0WJ19
ENSOGAP00000001464 ENSOGAP00000001464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]