SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001514 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001514
Domain Number 1 Region: 489-721
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-36
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 2 Region: 1563-1813
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.81e-34
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 99-246,291-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-32
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 4 Region: 1241-1400,1437-1514
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-28
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001514   Gene: ENSOGAG00000001691   Transcript: ENSOGAT00000001697
Sequence length 2499
Comment pep:known_by_projection scaffold:OtoGar3:GL873646.1:1122325:1369088:1 gene:ENSOGAG00000001691 transcript:ENSOGAT00000001697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGDEMPARYGGGGSGAAAGVVVGAGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPYTPFEYMILATIIANCIVLALE
QHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVL
TGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAIL
IFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
TQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFD
VGALRRTTIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMR
FYIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIK
MYGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYW
ASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAA
IMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNL
ANAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPARSVWEQ
RTSEMRKQNLLASREALYNEMDPDERWKASYARHLRPDMKTHLDRPLVVDPQENRNNNTN
KSRAAEPTVDQRLGQQRADDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGP
YGRESDHHAREGCPEQPGFWEGEADRGKAGDPHRRHAHRQGASRESRSGSPRGGADGEPR
RHRAHRRPGEEGAEDKAERRARHREGSRPARGGEGEGPEGGERRRRHRHGTYDADVRRED
KERRHRRRKETQGSGVPMSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESASP
HDSLSHSGLPQSPAKMGNSTDPGPMPVLPTMVTNPQNTAASRRTPNNPGNPSNPGPPKTP
ENSLIVTNPSSTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPKKEEE
KKEEEDDPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALA
AEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVS
GALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILI
VYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFH
YDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQF
VVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECLLKVMAFGI
LNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILL
WTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFRTF
FQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGIQNRECGNEFAYFYFVSFIFLCSFLM
LNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHYKDMYSLLRVISPP
LGLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAE
LRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQD
RTPLMFQRMEPPSPTQEGVPSQNALPSTQLDPGGGLMAHEGGIKESPSWVTQRAQEMFQK
TGTWSPERGPPTDMPNSQPDSQSVEMQEIGRDGYSDSEHYLPMEGQTRAASMPRLPAENQ
RRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRGHR
ASERSLGRYTDVDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHPPP
ADKERYTQEQPDHGRARARDQRWSRSPSEGREHMAHRQGSSSVSGSPAPSTSGTSTPRRG
RRQLPQTPSTPRPHVSYSPVIRKAGGSGPPQQQQQQQQQAVARPGRAATSGPRRYPGPAA
EPLAGERPPTGGHSSSRSPGMERRALGPALSESPRACRHGGARWPASGPHVSEGPPGPWH
HSYYRSSDYDEADGRGSLGNEEATAGAYDAPPAVRHASSGATGRSPRTPRASGPACASPY
RHRRLPNGYYPAHGLARPQGPGSRKGLHEPYSESDDDWC
Download sequence
Identical sequences H0WJ62
ENSOGAP00000001514 ENSOGAP00000001514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]