SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001532 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001532
Domain Number 1 Region: 328-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-22
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 
Domain Number 2 Region: 556-691
Classification Level Classification E-value
Superfamily PX domain 6.93e-22
Family PX domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001532   Gene: ENSOGAG00000001714   Transcript: ENSOGAT00000001719
Sequence length 946
Comment pep:known_by_projection scaffold:OtoGar3:GL873724.1:161296:236973:1 gene:ENSOGAG00000001714 transcript:ENSOGAT00000001719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRARAVGERMRQRLRLDAGRELCRQYPLFCFLLLGLSAASLLLHRYLHVLMIFWSFVA
GVVTFYCSLGPDSLLPNIFFTIKYKPKQLALQELFPQGHSCAVCGKVKCKRHRPSLLLEN
YQPWLDLKIPSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRVTLRFFASVLIRR
IHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEFLQQAALEEYGPELHVALRSRRDE
LHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFI
DDSPPEKATEPASPLVPFLQKFAEPRNKKPSVLKLELKQIREQQDLLFRFMNFLKQEGAV
HVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQ
RIAEGPYVDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSK
FNRGSLSLDDFRSTQKRGESFGISRIGSKIKGVFKSTTMEGAMLPNYGLAEGEDDFIEEG
IVVMEDDSPVEAVSTPNTPRNLAAWRISIPYVDFFEDPSSERKEKKERIPVFCIDVERND
RRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEF
QEYLQKLLQHPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLMKEKGQH
LEPFIMNFINSCESPKPKPSRPELTILSPTSENNKKLFNDLFKNNANRAENTERKQNQNY
FMEVMTIEGVYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNTLEMYTDYYLQCKLEQLFQ
EHRLVSLITLLRDAIFCENTEPRSLQEKQKGAKQTFEEMMNYIPDLIVRCIGEETKYESI
RLLFDGFQQPVLNKQLTYMLLDIVIQELFPELTKVQKEVTSVSSWM
Download sequence
Identical sequences H0WJ76
ENSOGAP00000001532 ENSOGAP00000001532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]