SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001588 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001588
Domain Number 1 Region: 373-519
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.8e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 559-678
Classification Level Classification E-value
Superfamily PX domain 9.55e-24
Family PX domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001588
Domain Number - Region: 118-212
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 0.0497
Family Cytochrome c oxidase subunit E 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001588   Gene: ENSOGAG00000001781   Transcript: ENSOGAT00000001784
Sequence length 959
Comment pep:known_by_projection scaffold:OtoGar3:GL873547.1:496219:604307:-1 gene:ENSOGAG00000001781 transcript:ENSOGAT00000001784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFALFQASLSIWGWGSLGIVLFLITFGPFVIFYLAFYILCFVGGGLVVTFLFGKTNSEKY
LEQCEHSFLPPPSTGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQY
WYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQK
ITEKDDQVKGTAEDFIDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPP
GDFQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSD
NVGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEIN
TVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLE
VLFSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVIVDDYLVAKLADTLNHEDPT
PEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGS
PTGSINLSLDDLSNVSSDDAVQLHAYISDTGVCNDHGKTYALYAITVHRRNLNSEEMWKT
YRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEM
MKASPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGM
TKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHYRVSAQLDDNVDDNIPLRVMLL
LMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFR
DAFWPNGILAETVPCRDKAIRMRTRIAGKTKLLAIMPDELKHIIGAETTRKGILRVFEMF
QHNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQTTQAPSLQKR
Download sequence
Identical sequences H0WJB8
ENSOGAP00000001588 ENSOGAP00000001588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]