SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001613 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001613
Domain Number 1 Region: 833-941
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 312-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-18
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 32-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 275-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000117
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 691-830
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000373
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 206-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.029
Further Details:      
 
Domain Number 7 Region: 165-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001613   Gene: ENSOGAG00000001810   Transcript: ENSOGAT00000001811
Sequence length 1019
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:5409487:5524041:1 gene:ENSOGAG00000001810 transcript:ENSOGAT00000001811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAVRWHLCLLIALGTRGRLAGATGLPGAVDVDECSEGTDDCHIDAICQNTPKSYKCL
CKPGYKGEGRQCEDIDECENDHYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDE
CQDNNGGCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRET
PKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPMCGCHQKYALHSDGRT
CIEKDEAAIERSQFNATSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVG
FTLQPDGKTCKDINECLVNNGGCDHSCRNTVGSFECGCRKGHKLLTDERTCQDVDECSFE
RTCDHICINSPGSFQCLCDHGYTLYGTTHCGDVDECSMDNGSCGHGCVNTKGSYECVCPL
GRRLHWNRKDCVEMGKCLSRTKTSPQAQLSCSKAGGVETCFLSCPGHTLFMPDSENSYIL
SCGVPGLQGKMLQKRNGTSSGGGGPSCSDAPTTPIKQKARFKIRDAKCHLWPHSREQTKE
TPRLPLLDNCHVTFVTLKCDSSKKKRRGRKSPSKEVSHITAEFEVEVKMEEASDTCEADC
MRKRAEQSLQAAIRTLRRSIGRQQFYVQVSGTEYEVAQRPAKALEGQGTCATGQMLQDSK
CGVCRPGSYFSGELGQCVPCVPGTYQDVEGQLSCTPCPSSDGLGVAGARNVSECGGQCSP
GFFSADGFKPCQACPVGMYQPEPGRTGCFPCGGGLLTKHEGAATFQDCEAKVHCSPGHHY
NTSTHRCIRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYI
ESPNYPGDYPANAECVWHIAPPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSITTY
ETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYA
SENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences H0WJD9
ENSOGAP00000001613 ENSOGAP00000001613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]