SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001634 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001634
Domain Number 1 Region: 157-307
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.08e-16
Family Nuclease 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001634   Gene: ENSOGAG00000001833   Transcript: ENSOGAT00000001837
Sequence length 747
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:17182099:17188315:-1 gene:ENSOGAG00000001833 transcript:ENSOGAT00000001837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRGRGPGGLAAQGMAGPLRGRVEELKQPWWRESTPLVLRHSEAARLAADALLERGEAAY
LRVISEERELPFLSTLDMDYMTSHVHGGPELSEAQGPEASGPDHLSLLSEVTSGTYFPMA
SDVDPPDLDLGWPEVPQATGFSPTQAVVHFQRDKAKNIKDLLRFLFSQARTVVAVVMDVF
TDMELLCDLIEASSRRGVPVYLLLAQEHLKHFLEMCYKMDLNGGHLPNMRVRSTCGDTYC
SKAGRRFTGQALEKFILIDCEQVVTGSYSFTWLCSQAHTSMVLQLRGRIVQDFDREFRCL
YAESRPVEGFCGGEDALTPRVPPPPTDALVFGPDIPNSTSSSPSSTSLSSIKRSPLMGHS
SYLALPGGGGCSDMGMGSSSPSPARREASGQPSLHRQLSDPNRGSPSGFYRANLGKLGAH
PWSQSSPALNYNGTSSLTLAVGSPLLPRSRPLLHFPRAIPVLSQLPENGLPGSQEPSPPR
DRQVPGKALETVEKKSSLSQSHGQLDLLVPFPRAREAGDPNSRVSPNSGSLRPGEQAPED
RRLFPGQSDSQLDLLPQAQSAGVAPESGPFRPGDQSPEDRRLSLNHSQGQVDLLVQYPKV
QGFRVIPEANSSSRHPTKQHPDERRQTLGHSQLDLITKFGPFRVEGPGPSGLPGPSPARM
AAVGSGEKRLTLGHSKLDLITKYHQLQGARQGPEPGLLGGPTGGHRNGNSNDLFRDEKRL
TLGHSKLDLITKYNKSKFKLLRSRFES
Download sequence
Identical sequences H0WJF7
XP_003788175.1.62490 ENSOGAP00000001634 ENSOGAP00000001634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]