SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001647 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000001647
Domain Number - Region: 191-272
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00122
Family Snake venom toxins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001647   Gene: ENSOGAG00000001850   Transcript: ENSOGAT00000001850
Sequence length 273
Comment pep:known_by_projection scaffold:OtoGar3:GL873627.1:973539:979777:-1 gene:ENSOGAG00000001850 transcript:ENSOGAT00000001850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFLLLMSLYLLGYAREASGQPDELPGSMNHKASVQQLSGEYFPLANPPDAEALYESSN
DNTLSEHGSSEHGSNEHNVAEHSSGEHATGEHTSVEHSTSEHAAGEQPSGEHNTGEQTSG
EHNAGEQGSGEHNAGEQASGEHNAGEQPSGEQPSGEQPSGEQASGEQASGEQLGEQAGGE
QPSGAPISSTSSGVLLNCHTCAYMNDQGKCLRGEGICTTQNSQQCMLKKIFEGGKLQFMV
QGCENMCPSMNLFSHGTRMQIICCRNRPFCNKI
Download sequence
Identical sequences H0WJG9
ENSOGAP00000001647 ENSOGAP00000001647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]