SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001652 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001652
Domain Number 1 Region: 1117-1205,1232-1384
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 430-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 798-953,993-1071
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-32
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 51-221,282-339
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-24
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001652
Domain Number - Region: 1389-1539
Classification Level Classification E-value
Superfamily EF-hand 0.00109
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001652   Gene: ENSOGAG00000001855   Transcript: ENSOGAT00000001856
Sequence length 1874
Comment pep:known_by_projection scaffold:OtoGar3:GL873574.1:8143156:8211756:1 gene:ENSOGAG00000001855 transcript:ENSOGAT00000001856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSSPQDEGLRKKQSKKSVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNNSLNIGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFTIVFLGVFTVILEQVNVIQSNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDITILTPQT
NSPQTPALSGSLRGCHLSGSGTGWSPAPACLGHKTWPFFGCSHHYCLVGPGCVEPIYQVN
DAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEED
LRGYMSWITQGEVMDVEDLREVNLVFDNTDSASRYKKKKERKENNDEFVDRHWRRWNRIF
RWKCHDIVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDIANRVLLALFTIEMLM
KMYGLGLRQYFMSIFNRFDCFVVCSGLLEILLVESGAMTPLGISVLRCIRLLRIFKITKY
WTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFP
QALISVFQVVLTGEDWTSMMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEEKSIMAKKLEQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLADIQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFIMLSSAALAAEDPIRADSMRNQILKHFDIGFT
SVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCTDL
SKMTEEECRGYYYVYKDGDPTQIELRRREWVHNDFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDSNKEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHY
NQSEEMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGKLCDPESEYAPGEEYTCGTNFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLR
TIEEEAAPEIHRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPP
VMANQRPLQFSEIELEELESPVFLEDFPQDPRTNTLARANTNNANANIAYGNSNHSNNRL
YSSIHYEREFLRETETPATRGGALGQRHRTLGPHGKPCLEKQRRQLTQRVMPGGRVSPAC
HQHPRADLPTPDERRHSIPGEEACEETPHGGGTKEGTSRYLAPATAQLIQEALVRGGLST
LADDAGFIMATGQALADACQMEPEEMEVAAAELLKGRESQEGMANALECLSHRSSLDSLN
QRQGSRETLIASRL
Download sequence
Identical sequences H0WJH4
ENSOGAP00000001652 ENSOGAP00000001652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]