SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001670 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001670
Domain Number 1 Region: 47-314
Classification Level Classification E-value
Superfamily L domain-like 1.22e-56
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 229-475
Classification Level Classification E-value
Superfamily RNI-like 1.8e-39
Family Rna1p (RanGAP1), N-terminal domain 0.073
Further Details:      
 
Domain Number 3 Region: 546-844
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.95e-28
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001670   Gene: ENSOGAG00000001875   Transcript: ENSOGAT00000001877
Sequence length 965
Comment pep:known_by_projection scaffold:OtoGar3:GL873574.1:6993179:7118439:-1 gene:ENSOGAG00000001875 transcript:ENSOGAT00000001877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPRGLRALWLCATLCVSVCAGDAPQPGPGPAVCPAPCHCQEDGIMLSADCSELGLSVV
PGDLDSLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILM
LQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNHIQHLGTHSFEGLHNLETLD
LNYNELQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIQLLPSGMCQQLPKLRVLELS
HNQIEELPSLHRCQKLEEIPSGLQHNCIWEIGADTFSQLSSLQSLDLSWNAIRSIHPEAF
STLRSLVKLDLTNNQLTTLPLAGLGGLIHLKLKGNLALSQAFSKDSFPRLRILEVPYAYQ
CCAYGLCASFFKASGQWEAEDFHLDEEETPKRPLGLLAGQAENHYDLDLDELQLEDGGHP
SVQCSPIPGPFKPCEHLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVTLPPVKFVV
GAIAGANTLTGISCGLLASVDALTFGQFAEYGARWEMGLGCRATGFLAVLGSEASVLLLT
LAAVQCSVSVSCVRAYGKAPSLGSVRAGALGCLMLAGLAAALPLASVGEYGASPLCLPYA
PPEGQPAALGFAVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIFA
DGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRL
WPHTGAPGPLDYAAASELEKSSCDSTQALVAFSDVDIILEASEAGQPPGLETYGFPSVTL
ICQQPGTPRPEDSHCVEREGTLFGNPQPSMDGELWLRAEGASSAAGASSVGGSLRPSGSA
FAPHL
Download sequence
Identical sequences H0WJJ1
ENSOGAP00000001670 ENSOGAP00000001670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]