SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001691 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001691
Domain Number 1 Region: 213-283
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.09e-26
Family PCI domain (PINT motif) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001691   Gene: ENSOGAG00000001895   Transcript: ENSOGAT00000001899
Sequence length 318
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:12289539:12301431:1 gene:ENSOGAG00000001895 transcript:ENSOGAT00000001899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPLVYLAVATLLVCVIFFLTRSRSREAAAGQEPLHNEEEPVVAGQVAQPRPLEPEEQR
AGGRARRRRDLGSRLQAQRRAHRVAWAEVDENEDEAVIPAYPAQEEEGTEKPVETHPSGK
IGAKKLRKLEEKQARKAQREAEEAEREERKRLESQREAEWKKEEERLRLEEEQKEEAERK
AREEQAQREHEEYLKLKEAFVVEEEGVGETMTEEQSHSFLAEFINYIKQSKVVLLEDLAS
QVGLRTQDTINRIQDLLAEGTLTGVIDDRGKFIYITPEELTAVANFIRQRGRVTIAELAQ
ASNSLIAWGRESPAQAPA
Download sequence
Identical sequences H0WJK9
ENSOGAP00000001691 ENSOGAP00000001691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]