SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001807 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001807
Domain Number 1 Region: 9-260
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-85
Family Eukaryotic proteases 0.0000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001807   Gene: ENSOGAG00000002023   Transcript: ENSOGAT00000002025
Sequence length 263
Comment pep:novel scaffold:OtoGar3:GL873566.1:8609036:8611970:1 gene:ENSOGAG00000002023 transcript:ENSOGAT00000002025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLWLLSCWALLGTTFGCGVPAIHPVVSGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEEDIQVLKIAKVFKNPKFSIFTVRND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNAPQTPDKLQQAALPL
LSNTECKKFWGSKITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCST
TTPAVYARVTALMPWVQEILAAN
Download sequence
Identical sequences H0WJV9
XP_003791370.1.62490 ENSOGAP00000001807 ENSOGAP00000001807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]