SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001819 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001819
Domain Number 1 Region: 49-149
Classification Level Classification E-value
Superfamily F-box domain 6.15e-20
Family F-box domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001819   Gene: ENSOGAG00000002038   Transcript: ENSOGAT00000002040
Sequence length 387
Comment pep:known_by_projection scaffold:OtoGar3:GL873582.1:9226650:9244258:1 gene:ENSOGAG00000002038 transcript:ENSOGAT00000002040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSEPRSGASSPPPPPSDWSRLEAAIVSGWRTFWQSVGKERAARAAAREEAEEAASTLT
RLPIDVQLYILSFLSPHDLCQLGRTNRYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD
IEILKKPISEVTDGTFFDYMAVYKMCCPYTRRASKSSRPMYGAVTSFLHSLIIHNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLSNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSLQNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWKDEFSHIMAMTDPAFGSSGRPMLVLSCISQADVKRMPCFYLAHELRLNLLNHPWMVQ
DMEAETLNGFLNGIEWILEEVESKRAR
Download sequence
Identical sequences H0WJX0
ENSOGAP00000001819 ENSOGAP00000001819 XP_003793006.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]