SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001855 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001855
Domain Number 1 Region: 135-488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.34e-83
Family Protein kinases, catalytic subunit 0.000000381
Further Details:      
 
Domain Number 2 Region: 2-132
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-36
Family Regulator of G-protein signaling, RGS 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001855   Gene: ENSOGAG00000002075   Transcript: ENSOGAT00000002077
Sequence length 541
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:2889479:2958156:-1 gene:ENSOGAG00000002075 transcript:ENSOGAT00000002077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRDYCSLCDKQPIGRLLFRQFCETRPGLECYIQFLDSVSEYEVTPDEKLGEKGKEIMTKF
FTPKSPVFIAQVGQDLVSQTEEKLLQRPCKELFLACAQSVHDYLRGEPFHQYLGSMYFDR
FLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGES
MALNEKQILEKVNSRFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERAL
FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGELIRGRVGTV
GYMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYS
HKFSEEAKSICKMLLSKDVKQRLGCQEEGAAEVKRHSFFRNMNFKRLEAGMLDPPFVPDP
RAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGP
NGTLSPDLNRSHPPEPPKKGLLQRIFKRQHQNNSKSSPSSKTSFNHHINSNHISSNSTGS
S
Download sequence
Identical sequences H0WJZ6
ENSOGAP00000001855 ENSOGAP00000001855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]