SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001931 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001931
Domain Number 1 Region: 297-695,776-781,812-854
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-95
Family FAD-linked reductases, N-terminal domain 0.000000000000832
Further Details:      
 
Domain Number 2 Region: 192-298
Classification Level Classification E-value
Superfamily Homeodomain-like 1.79e-30
Family SWIRM domain 0.00000121
Further Details:      
 
Domain Number 3 Region: 680-788
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001931   Gene: ENSOGAG00000002158   Transcript: ENSOGAT00000002162
Sequence length 877
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:2480995:2546312:-1 gene:ENSOGAG00000002158 transcript:ENSOGAT00000002162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGKKAAAAAAAAAAAAAAVTEAGPGAAGGAENGSEVAAPAAGLSGPADVGPGAAGERT
PRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVE
YREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQ
DDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQ
LWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTG
KVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGG
NPMAVVSKQVNMELAKIKQKCPLYEANGQAVNLNVPKEKDEMVEQEFNRLLEATSYLSHQ
LDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKI
KELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANP
PSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVP
VALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPP
AVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFW
NLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADP
WARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGAL
LSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences H0WK61
ENSOGAP00000001931 ENSOGAP00000001931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]