SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001933 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001933
Domain Number 1 Region: 1527-1724,1752-1777
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-37
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 1207-1362,1398-1477
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-37
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 130-277,367-436
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 766-915
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-24
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001933
Domain Number - Region: 1786-1831
Classification Level Classification E-value
Superfamily EF-hand 0.00694
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001933   Gene: ENSOGAG00000002160   Transcript: ENSOGAT00000002164
Sequence length 2002
Comment pep:known_by_projection scaffold:OtoGar3:GL873609.1:4182906:4262896:-1 gene:ENSOGAG00000002160 transcript:ENSOGAT00000002164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTLLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDDDENKPKPNSDLEAGKNL
PFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPLNPVRKIA
IKILVHSYPFYSTLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILA
RGFCLEDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKT
IVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPNDSAFETNTTSYF
NGTTDSNGTFVNITLRTFNWKDYIGDESHFYVLEGQNDPLLCGNGSDAGQCPEGYICVKA
GRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYL
VNLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQSAVAAASAASRDFSG
MGGLGELLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGTHKGEGDRFPKSESEDSVRR
RSFLFSMDGNRLSGDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFA
DDEHSTFEDSESRRDSLFVPHRQGERRNSNVSQASMSSRMVPGLPANGKMHSSVDCNGVV
SLVGGPSALTPPSGLFGLQGTTTETDIRKRRLSSYQISMEMLEDSSGRQRAMSIASILTN
TMEELEESRQKCPPCWYRFANVFLIWDCCDAWLKIKHLVNLIVMDPFVDLAITICIVLNT
LFMAMEHYPMTQQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSL
SLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVF
IFAVVVWLMLGLKCKGRICVFLNFCDLMLQFLSRVWGTFAVIKVCGYWTKISYSKGKMVK
HLCLFYHIALQIGHLAVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYV
KNKMRECFQRAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLKDGNGTTSGVGTGS
SVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATSS
SEGSTVDVAPPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNLRKT
CYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLK
WVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGSMFKVSEV
NNLSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPEY
EENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKK
LGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGNDMTVVL
SRINLVFIVLFTGEFVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFVSPT
LFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFA
YVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDAIHPGSSVK
GDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWE
KFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTK
RVLGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQ
RLKKLINKYDKETIKGRIDLPLKPDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDK
EKFEKDKPEKESKEIEVSENQK
Download sequence
Identical sequences H0WK63
ENSOGAP00000001933 ENSOGAP00000001933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]