SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001935 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001935
Domain Number 1 Region: 1193-1348,1387-1466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.2e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1516-1766
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 745-892,926-973
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 128-273,339-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001935
Domain Number - Region: 1775-1818
Classification Level Classification E-value
Superfamily EF-hand 0.0127
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001935   Gene: ENSOGAG00000002162   Transcript: ENSOGAT00000002166
Sequence length 1991
Comment pep:known_by_projection scaffold:OtoGar3:GL873609.1:4370211:4460224:1 gene:ENSOGAG00000002162 transcript:ENSOGAT00000002166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAQRPKQERKDEDDENGPKPNSDLEAGKSL
PFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRKIA
IKILVKYSTLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPGTGIRISLLMSCHKPQP
DFLSLNPAPLSFMCHMSVITHQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQD
FWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEA
EFQQMLEQLKKQQEEAQXLSFILFYFFNFSLSFLLSLSLSQKYSIYIKEKRSSLKKNRRK
KKKQKEQSGEEEKDEKVRKSESEDSIRRKGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSL
FSPRRNSRASLFSFRGRTKDVGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRHSNVS
QASRASRVLPILPMNGKMHSAVDCNGVVSLVGGPSALTSPAGQLLPEVRPTKHSTWDRGT
TTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSMASILTNTMEELEESRQKCPPCWYKFAN
MCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSNVLSVG
NLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRL
LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKI
SSDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVV
LNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRKLREFIQKAFVRKQK
ALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMS
FINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEG
EQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFI
VFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAW
CWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAI
PSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQ
TARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFV
IFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIP
RPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLF
TGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIG
RILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDM
FNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIF
FFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIE
FSKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDA
LRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVSSIYKK
DKGKECDGTPIKEDPLIDKLNENSTPEKTDMTPSTTSPPSYDSVTKPEKEKFEKDKSEKE
DKGKDIRESKK
Download sequence
Identical sequences H0WK64
ENSOGAP00000001935 ENSOGAP00000001935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]