SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001978 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001978
Domain Number 1 Region: 538-1014
Classification Level Classification E-value
Superfamily Ras GEF 6.54e-141
Family Ras GEF 0.0000000000000123
Further Details:      
 
Domain Number 2 Region: 2-148
Classification Level Classification E-value
Superfamily Histone-fold 3.97e-50
Family TBP-associated factors, TAFs 0.000000325
Further Details:      
 
Domain Number 3 Region: 169-371
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-43
Family DBL homology domain (DH-domain) 0.00000000312
Further Details:      
 
Domain Number 4 Region: 389-544
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-39
Family Pleckstrin-homology domain (PH domain) 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001978   Gene: ENSOGAG00000002210   Transcript: ENSOGAT00000002215
Sequence length 1304
Comment pep:known_by_projection scaffold:OtoGar3:GL873614.1:2168531:2298862:1 gene:ENSOGAG00000002210 transcript:ENSOGAT00000002215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIAD
AQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYV
RNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFM
AEIRQYIRELNLIIKVFREPFVSNSKLFSTNDVENIFSRIVDIHELSVKLLGHIEDTVEM
TDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDHFLSQLSKPGAALYLQSIGE
GFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEK
ICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGT
LTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNE
YKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRL
PSADVYRFAEPDSEENIIFEENMQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLT
TYRSFCKPQELLSLIIERFEIPEPEPTEADRIALENGDQPLSAELKRFRKEYIQPVQLRV
LNVCRHWVEHHFYDFERDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPG
HNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVW
TKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFN
GVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPF
FGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVELDIKR
FFENLNPMGSSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGT
MRHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDH
SSPFHSSNDTVFIQVTLPHGPRSASVSSISLTKGPDDVPIPPPVPPRRRPESAPAESSPS
KIMSKHLDSPPAIPPRHPTSKAYSPRYSISDRTSVSDPPESPPLLPPREPVRTPDVFSSS
PLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAG
PPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences H0WK98
ENSOGAP00000001978 ENSOGAP00000001978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]