SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002002 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002002
Domain Number 1 Region: 35-165
Classification Level Classification E-value
Superfamily Lysozyme-like 1.76e-19
Family G-type lysozyme 0.0000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002002   Gene: ENSOGAG00000002242   Transcript: ENSOGAT00000002244
Sequence length 177
Comment pep:known_by_projection scaffold:OtoGar3:GL873598.1:8228702:8237001:1 gene:ENSOGAG00000002242 transcript:ENSOGAT00000002244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSVMLWGLIGLIGTLVDSYLFTHLMSPHPNPHHGCYGDIMTMETLGPSCDLNTLISCG
IRGSEMFVEMDLRAINPYQTLIKEVGQRHCVDPAVIAAIISRESRGGTTLRDGWEHRGLK
LGLMQLDKQIYHPAGTWDSKEHLLQAVGILTDGIKIIQKNFPTWSAAQHFKGKFFLL
Download sequence
Identical sequences H0WKB8
ENSOGAP00000002002 ENSOGAP00000002002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]