SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002027 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002027
Domain Number 1 Region: 14-49,98-165
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-24
Family Voltage-gated potassium channels 0.0061
Further Details:      
 
Domain Number 2 Region: 162-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-22
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002027   Gene: ENSOGAG00000002272   Transcript: ENSOGAT00000002274
Sequence length 336
Comment pep:known_by_projection scaffold:OtoGar3:GL873635.1:2744559:2798344:1 gene:ENSOGAG00000002272 transcript:ENSOGAT00000002274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY
GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHVRWGFSKQVVA
IVHAVTLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLILGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS
FSSIIDQAAGMKDDQKQNEPFVATQLSPYPDGSAHH
Download sequence
Identical sequences H0WKD7
ENSOGAP00000002027 ENSOGAP00000002027 XP_003797479.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]