SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002155 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002155
Domain Number 1 Region: 238-474
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-53
Family DBL homology domain (DH-domain) 0.0000594
Further Details:      
 
Domain Number 2 Region: 472-598
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-36
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002155   Gene: ENSOGAG00000002411   Transcript: ENSOGAT00000002416
Sequence length 1165
Comment pep:novel scaffold:OtoGar3:GL873821.1:340349:361356:1 gene:ENSOGAG00000002411 transcript:ENSOGAT00000002416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVTVGTNFLPSRPAASANTVREDAALFSRRIPPRHKGRAAQPGTAGPRAQSVNMGNAHSK
GGDRHGSLPGHPELSFYSSFPRKWSENVFLDNELLTSKILSVLRPQSERGLHSGGLRYPA
HFLSTNSVFASVAASLKEHPRSTLLSDGSPAFSRNVGMTVSQKGGSQPALSPAGTGMRLG
PISGEMDEADSVFLKFKQAADDSLSLTSSNTESIFVEDPYAASLRSEIESDSHEFEAESW
SLAVDLAYAKKQKREVVKRQDVLYELTQTEVHHVRTLKIMLKVYSRALQEELPGSCDALS
RLCVCADDLLDMHSRFLSLLKERRHQSLEEGSDRNYVIQKIGDLLVQQFSGENGERMKEK
YGVFCSSHKEAVSQYKLLLQSKKFQNLIKKIGNSSIVRRLGMQECILLVTQRITKYPVLV
ERIIQNTEAGTEDYEDLTQALNFIKDIISQVDTKVSECEKGQRLREIAGKMDLKSSSKLK
NGLTFRKDDMLQRQLHLEGTLCWKATSGRLKDVLAVLLTDVLLLLQEKDQKYVFASVDSK
PPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKEDRNTWMAHIRRAVESCPD
EEEGPFSEAEEERKVIEYRAMRLRDFQERLSLKDQLIVQSLAEKQQIYLEMAEMSGLEDV
AQARTLFHGADLAETLQGELIFKSAMSEMEGIQSLICRQLSCAVSQAEDGDSSVGLPRRA
ETFGGYDSTNSPSKNGSFKKKVCSTDPRPGDWQGPANSMDPKLGDNNTSGGSEESPQVME
APGMECGPRLPTVLESELVRRFQMLYQLLLSLQAVVVQQDSYVETLREREKQFRLQSTRG
NLLLEQERQRNFEKLREEQAGVEKLQSQLRQEQQRWERERQRQCQELEHTAAQLQEREDE
VRRLQERLAQERCELEGQRQAYQHDLERLREAQRAVERERERQELLRRLKKQNTAPGSLP
PDALAEAQPASHPPSFNGDGLEGSRVNMVLPGIGPEYTERPEVARRDSVPAEGRPAKSDV
PIQLLSATNQIQKQAAVQQQIPTKLAAFTKGGKDKGSKSRGSQRWESSASFDLKQQLLLN
KFIGKDESASRSRRSLSPILPSSHSPAPLAEPCSLAPSPAPVDSPPDCFSLKAGTTSFLP
VPPSPSPATPFTAKEEASKEDVIFF
Download sequence
Identical sequences H0WKN8
ENSOGAP00000002155 ENSOGAP00000002155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]