SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002162 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002162
Domain Number 1 Region: 189-430
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-83
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 99-196
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000235
Family Hepsin, N-terminal domain 0.043
Further Details:      
 
Domain Number 3 Region: 53-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002162   Gene: ENSOGAG00000002420   Transcript: ENSOGAT00000002423
Sequence length 434
Comment pep:known_by_projection scaffold:OtoGar3:GL873627.1:6442784:6460218:-1 gene:ENSOGAG00000002420 transcript:ENSOGAT00000002423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEPGPDLPNNNDDASLNKPGSALETFKKVGIPIIAAVVGLATIITVAIVIKQILEKHYFF
CGQPLHYIPRRNLCNGEPDCASGEDEEHCVKNMPEGPKVSVRLSKDQSTLQVLDQDTKKW
YSACFDQFTEAMAKTACRQMGYSSKPVFKDVRMDPDQELDVVLVTEKTQQLRVLNTSRPC
LSGSLVSLNCLACGESLKSPRVVGGSQASPDSWPWQVSLQYNKQHICGGSILDHRWILTA
AHCFRKYLDVPNWKVRVGSNKAGNFLTLPVAKIVVIELNPIYPKEKDIALIKLQSPLIFS
DRIRPICLPFFNEEFTSATPLWVIGWGLTEQNGGKMSDVLMQASVQFIDRRQCNADDAYQ
GEVMEKMICAGIPEGRVDACQGDSGGPLMYRSTQWEVVGIVSWGYGCGGPSTPGVYTKVA
AYLNWIYSVRKAEL
Download sequence
Identical sequences H0WKP5
ENSOGAP00000002162 ENSOGAP00000002162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]