SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002199 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002199
Domain Number 1 Region: 414-564
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-50
Family MATH domain 0.0000000357
Further Details:      
 
Domain Number 2 Region: 364-413
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 3.14e-20
Family Trimerization domain of TRAF 0.0000865
Further Details:      
 
Domain Number 3 Region: 112-211
Classification Level Classification E-value
Superfamily TRAF domain-like 3.07e-17
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 
Domain Number 4 Region: 42-99
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000625
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 5 Region: 212-253
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000015
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000002199
Domain Number - Region: 270-410
Classification Level Classification E-value
Superfamily Tropomyosin 0.00333
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002199   Gene: ENSOGAG00000002459   Transcript: ENSOGAT00000002462
Sequence length 568
Comment pep:known_by_projection scaffold:OtoGar3:GL873668.1:1349995:1384467:1 gene:ENSOGAG00000002459 transcript:ENSOGAT00000002462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSKKMDSSGTLQTNPPLKLHPDRSSGTSVFVPEQGGYKEKFVKAVEDKYKCEKCHLVL
CNPKQTECGHRFCETCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNE
SKGCTEQLTLGHLLVHLKNDCQFEELPCVRADCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQVKAHEASSAVQHVNLLKEWSSSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
Download sequence
Identical sequences H0WKS3
ENSOGAP00000002199 ENSOGAP00000002199 XP_003799375.1.62490 XP_003799376.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]