SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002232 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002232
Domain Number 1 Region: 38-258
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-60
Family DBL homology domain (DH-domain) 0.0000178
Further Details:      
 
Domain Number 2 Region: 244-390
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 504-635
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-32
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 407-521
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-27
Family DEP domain 0.0037
Further Details:      
 
Domain Number 5 Region: 622-706
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000985
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 706-770
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000306
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002232   Gene: ENSOGAG00000002497   Transcript: ENSOGAT00000002501
Sequence length 1654
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:10241727:10431857:-1 gene:ENSOGAG00000002497 transcript:ENSOGAT00000002501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPSGGDPSGDGVGDGAHPDSRTPGASAPSSSQCAAARESERQLRLRLCVLNEILGTERD
YVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKILFSNIEDILEVHKDFLAALEYCLQP
EPQSQHELGNVFLRFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKT
TDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQNALQAMKTVCSNINETKRQ
MEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKR
KSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHN
TAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNK
KVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKH
QFKNEQVMYRFRYDDGTFKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVL
PGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEMEG
TSSKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEMAGLQ
VGRKIYSINEDLVFLRPFSEVESILNQSFCARRPLRLLVATKAKEIVRVLDHPEALCFQI
RGAAPPYVYAVGRGSEAVAAGLCAGQCILKVNGNNVMNDGAPEVLEHFQAFRSRGEEALG
LCQWIYRTHEDAQEARASQEAPGEEGEGTGEEDQPDAAFSLLSLGPQLSLHEDGPVVSLT
VDNVHLEHGVVYEYVSTAGVKCHALEKIVEPRGCFSLTAKILEAFAADDSVFVQNCGRLM
ALSSAIVTMPHYEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGL
DFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPDQGHLNPMSYNQHCITTM
AAPSWKCLPAADGDPQGQGLNDSVFGQANGALGQEDRGLSFLLKQEDREIQDAYLQLFTK
LDVALKEMKQYVTQINRLLSTITEPTSGGSCDPPLAEEASSSPLVSEENEMDRTDHGGSK
KVCFNVSEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELP
CDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGSVMGRAFEETKHFPMDHSLQEFKQKEE
CTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDA
IFCQALVAAVCTFSEQLLAALSYRYNNNGEYEESSRDASRKWLEQVAATGVLLHWQSLLS
PATVKEERTMLEDIWVTLSELDNVTFSFKQLDENYVANTSIFYHIEGSRQALKVIFYLDS
YHFSKLPTRLEGGASLRLHTVLFTKALENVEGPPSPGSQAADDLQQEINVQSLEKVQQYY
RKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGSVGSLGAGLI
PISSELCYRLGACQITMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGP
RVEILAKNLRVKDQMPQGASRLYRLCQPPVDGDL
Download sequence
Identical sequences H0WKV2
ENSOGAP00000002232 ENSOGAP00000002232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]