SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002270 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002270
Domain Number 1 Region: 628-689,896-1236
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-118
Family Ras GEF 0.0000124
Further Details:      
 
Domain Number 2 Region: 224-447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 23-132
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-18
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 4 Region: 435-590
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000262
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002270   Gene: ENSOGAG00000002537   Transcript: ENSOGAT00000002541
Sequence length 1239
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:14959919:15204278:1 gene:ENSOGAG00000002537 transcript:ENSOGAT00000002541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCTCERTPAPPRAGAGPGGGRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAETEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAASFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDADICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLADGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTSSSSGSPTTTHSPAASPP
PHTGKVPLDLSRGLPSPEQSPGSVEENADNPRMDLCNKLKRSIQKAVLESAPADRAGGES
SPAADATELSPCRSPSTPRHLRYRQPGGQTGDNAHCSVSPASAFAIATAAAGHGSPPGFN
NSERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDIHLKLEDIIQMTDCLKAECFETLSAMELAEQITLLDHIVF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWV
AVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKIVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
SYRIDHQPKVTQYLLDKALIIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences H0WKY7
ENSOGAP00000002270 XP_003786001.1.62490 ENSOGAP00000002270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]