SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002337 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002337
Domain Number 1 Region: 645-755
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000028
Family Regulator of G-protein signaling, RGS 0.0074
Further Details:      
 
Domain Number 2 Region: 374-493
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000353
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000002337
Domain Number - Region: 877-982
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000542
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number - Region: 83-196
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00706
Family Regulator of G-protein signaling, RGS 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002337   Gene: ENSOGAG00000002611   Transcript: ENSOGAT00000002614
Sequence length 1080
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:11260028:11348498:-1 gene:ENSOGAG00000002611 transcript:ENSOGAT00000002614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLHVEIIASTNLIILLEDEVFADFFNTFLSLPVFGQTPMYTVENSQWSLWPEIPSDTVAK
YKGLLTWLEKYRLPFFCKTNLCFHYILCQELISFIKSPEGGEDLVDFWILAEKILSIDET
DIEVRDYYLSLLLMLKATHLQEGSRVVTLCRMNIKSLLNLSIWHPNQTTSRREILSHMQK
VALFKLQSYWLPNFYTHAKMAMAKEEACQGLMQEYETRLCSICCSHTGGLPLNMTIKKND
HFQKEYSSRKTKRKMWQLINPGSWFLEMDCEPDTNIVPPQERRPQEKVVKQMPPLRVASS
KEKIINLPEKRSHSARKLSMKKKAKRHLHMEGLFETKFTTHLRIATPFTHYSSQVTMKRA
IKQSLCIGYTHWALCADAYAGSPFRSHLKKQNLKVETQLLDLWQDLHHFLGVLMNNRKNG
NAVFRHMLGNRICELYLNEQIGPPLPLKSQIIQGLKELLPYGNVNPWIPKAQKEICKILR
PWYDEFLNEEDYCFLSFTTQNRLISSIRPKRDTISKEENILLCKRVQESLELSHALATTE
KMDSMQWQKIATEDLRQGGSLQVELSPPMFLFTDISKMSFEELCCKYPKIAIEKISDDYK
TYCERAPHIDYPVEIVKEPKVVRLSLSRKMSVFKKSGLRKPSMRPRNMTEVLLNSQHVEY
FREFLKERKAESPLDFLVAVQRIVIETNEKAYKSLLENLLKTFFQSDVSPEEILQCDAPL
IREVANMRHVSTTMLLMLQSFIMKSVEEKWFKDYQELFPARPVETETQIQPSPRKPSRTA
TTHLQESQKRGWMKMINFIRSFCKYRRFMSDPNKRQEFEDFLHLEMQISKDNFSVSTNTS
GRSALFPANVRNIEQENGEMTFVKRRIYGHRLITVNFAINDIYFFSEMEKFNDLVSSAQM
LLVNRTYSENDVLLMRSKINIILKLFLHSDIPPKLRVNIPESQKDSIITAITEGHLDRSI
FHGAIMSLFPVVMYFWKRYCAWKVITSYFQYLGKKVKERKGPPKTTYKYPPSTGGKEDQA
ILRFTLLRGIEWLRPQHREVTINSVQNSSSSNLTHSGLTLPTVQMCPVPGHKVHGNKKKR
Download sequence
Identical sequences H0WL40
ENSOGAP00000002337 ENSOGAP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]