SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002340 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002340
Domain Number 1 Region: 55-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.5e-45
Family Regulator of G-protein signaling, RGS 0.000000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002340   Gene: ENSOGAG00000002615   Transcript: ENSOGAT00000002617
Sequence length 202
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:11207300:11211429:1 gene:ENSOGAG00000002615 transcript:ENSOGAT00000002617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGSDTGSVGKFEWGSKHSKESRNFPEDVL
GWKESFDLLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLTSRAQRIFEE
FICSEAPKEVNIDHETRELTRTNLQAATATCFDVAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASVSLSGSSPAEPSHT
Download sequence
Identical sequences H0WL43
ENSOGAP00000002340 XP_003785694.1.62490 ENSOGAP00000002340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]