SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002365 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002365
Domain Number 1 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.3e-21
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002365   Gene: ENSOGAG00000002642   Transcript: ENSOGAT00000002645
Sequence length 500
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:9924803:9962281:-1 gene:ENSOGAG00000002642 transcript:ENSOGAT00000002645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLSQEGLDKI
LQVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTAIFILWGVLVHLVIPPF
VFMVTEEWDYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRTALQVAGSGASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTTSRGGERGPGPGRGTQDSGLPAIPPSLVPLVVYSKNRVPSLEEVS
QTLRSKGHVSKTPSEEAVTRTPEEGSPTSEVFINQLDRISEEGEPWDAQDYHPLISQNAN
ITFVNEEAGLSDEETSKSSLEDNLAEEERPEQRPEAEVPLNLGEFPSSDESTFTSTESEL
SVPYEQLMNEYNKANSPKGT
Download sequence
Identical sequences H0WL61
ENSOGAP00000002365 ENSOGAP00000002365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]