SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002366 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002366
Domain Number 1 Region: 14-48,97-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-25
Family Voltage-gated potassium channels 0.0021
Further Details:      
 
Domain Number 2 Region: 162-282
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-20
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002366   Gene: ENSOGAG00000002643   Transcript: ENSOGAT00000002646
Sequence length 332
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:10022459:10036283:-1 gene:ENSOGAG00000002643 transcript:ENSOGAT00000002646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPRARAAPKVRGRRCAVPSTIFLLLAYLAYLALGTGVFWALEGRAAQLSSLSFQRDKW
EMLRNFTCLDSPALDSLIRDIIQAYKNGASLLSNTTSMGRWEFVGSFFFSVSTITTIGYG
NLSPHTMAARLFCIFFALVGIPLNLVVLNRLGHLMQRGVHHCARRLGGTWQDPGKARWLV
GSGALLAGLLLFLLLPPLLFSHMEGWSYIEGFYYSFITLSTVGFGDYVIGMNPSRRYPLW
YKNMVSLWILFGMAWLALIIKLILSLLETPGGACSCYECSFKEDFKSQCWRHRPNREPDS
HSPQQGCYPEGSMGIIQHLGPSTQVARYVKDS
Download sequence
Identical sequences H0WL62
XP_003789213.1.62490 ENSOGAP00000002366 ENSOGAP00000002366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]