SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002367 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002367
Domain Number 1 Region: 14-40,89-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-23
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 151-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-18
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002367   Gene: ENSOGAG00000002644   Transcript: ENSOGAT00000002647
Sequence length 294
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:10038091:10044811:-1 gene:ENSOGAG00000002644 transcript:ENSOGAT00000002647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTGLCGCWGGRALPLLLAYISYLLLGATVFQLLEKQAEAQSRHEFQFEKLRFLENYTC
LDQRALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGFGNLSPSTEA
GQVFCVFYALVGIPLNVVFLNHLGTGLRAHLAIRERWEDQPRRSQQLQVLGLALFLILGT
LVILIFPPLIFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYVSMYRSLTAVWI
LLGLAWLALILPLGPLLLHRCSQLWLLSRGLGPKDKSAPDPSGLPRPQKIPISA
Download sequence
Identical sequences H0WL63
ENSOGAP00000002367 ENSOGAP00000002367 XP_003789214.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]