SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002382 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002382
Domain Number 1 Region: 1100-1262,1290-1369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-40
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 567-794
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.37e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 1-155,257-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-33
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1417-1663
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.56e-33
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002382   Gene: ENSOGAG00000002655   Transcript: ENSOGAT00000002662
Sequence length 2152
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:8552867:8630092:-1 gene:ENSOGAG00000002655 transcript:ENSOGAT00000002662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGI
FGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILV
NLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQGDVALPPYYQP
EEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGTGRQDLNASGLCVNW
NRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFI
LLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIF
QYVCHILRKAKRRALGLYQALQNRRQALGPGAPAPAPAKPGPHAKEPRHYNGKTKAQVAA
GSQRGSEPAQALEGSLLALPAHSRTSSPPPHQLCPRHSPLDPTPHALVQPISATLASDPA
SCPRCQHEAGRRPSGLGSTDSGQEGSGSGGSCGGEDEADGDGAQSSEDGASSGLEKEDEE
EQADGPARLCGAVWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQASELTNVL
EICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRT
FRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRT
DTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYV
LFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDISGDPKLCPVPMTPNG
HLDPSLPLAGHLGHTGAVAPAPRLSLQPDPVLVALGSRKSSVMSLGRMSYDQRSLSSSRS
SYYGPWGRSGAWASRRSSWNSLKHKPPSAEHESLLSAERGSSTRACEAVGDEAPPRVVPL
HAPHTHHAHHAHHGHHLAHRHRHHRRTLSLDTRDSVDLAELVPTMGAHPRAAWRAAGPAP
GHEDCNGRMPSIAKDVFTKMDDRRDRGDDEEEIDYTLCFRVRKMIDVYKPDWCEVRRNWS
VYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNY
IFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILG
VLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFK
GKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNG
LDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRR
EEKRLRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHY
NQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLE
EIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLL
FFIYAALGVELFGKLVCNEENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLR
DCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAE
IELEMAHSLGPSPRPPTSSPGVPGHGPGGVGSGCDAEGRLCRRCYSPAQETLWLDSVSLI
IKDSLEGELTIIDNLSGSVFHHYASPAGHGKCLHDQQEVQLAETEAFSLNSDRSSSILLG
DDLSLEDPTICPSGHKDSKGELDLPEPMCVGDLGECFFPLSTTAISSGPENFLCEMEAIP
FNPVRSWLKHESSQALPSRPFSPDASSPLLPMPPEFFHPAVSASQKGQEKGTGAESLPKI
SLQGSWASLRSPSVNCTLLRQATGSDTSLDASPSSSAGSLQTTLEDSLTLSDSPRRTLGP
PAPAMGPRAGLSPAARRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHHDSMDPSDE
EGRGGASGGGAGSEHSETLSSLSLTSLFCPPPPPPPPGLTPSRKFSSTSSLATGPGRPRA
PTAQPRGLARSPSWAADRSKDPPGSGLGPSGPEPQPPPGDLELGDAASKRKR
Download sequence
Identical sequences H0WL76
ENSOGAP00000002382 ENSOGAP00000002382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]