SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002464 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002464
Domain Number 1 Region: 92-293
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-57
Family DBL homology domain (DH-domain) 0.0000271
Further Details:      
 
Domain Number 2 Region: 278-402
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-33
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002464   Gene: ENSOGAG00000002749   Transcript: ENSOGAT00000002752
Sequence length 1213
Comment pep:known_by_projection scaffold:OtoGar3:GL873634.1:5699882:5715341:-1 gene:ENSOGAG00000002749 transcript:ENSOGAT00000002752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSATLHQDASQERPVSLMSTTSSSGSSRDSHGAMEEPNGSEAPVENSTGSPRARHLPN
SNNNSSSWLTVKGPRSPFGSRVATGAAHHKLGYLGRVVREIVETERTYVQDLRSIVEDYL
LKIIDTPGLLKPEQVSTLFGNIENIYALNSQLLRDLDGCNSDPVAVASCFVERSQEFDIY
TQYCNNYPNSVAALTECMRDKQQAKFFRDRQEVLQHSLPLGSYLLKPVQRILKYHLLLQQ
IAIHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTIY
GELVLEGTFRVHRVRNERTFFLFDKTLLITKKRGDHFVYKGHIPCSSLMLIESTRDSLCF
TVTHYKHSKQQYSIQAKTVEEKRSWTHHIKRLILENHHAIIPQKAKEAILEMDSCYPNRY
RYSPERLKKAWSSQDEVSSHVRQGRRQSEPSRYLLRQLNEKGDAAGMKGKGRRESEGPGS
CRRPSGRSPSSAEKRMSFESISSLPEVEPDPESGTEQEVFAAEEGPSTEEMLSDTESPEV
LETQHDAHQELPEVDHPDDVAEFTVAESTEDLKALSSEEEEDMGAAQEPESLLPPSVLDQ
ASVIAERFVSSFSRRSSLALEDGKPNGLGTPRLVSRSSSVLSLEGSEKGLARCGSSSDSL
SCQLPQGMDISVGVATDSSPSVNGTESLSPGCPVEPDRSSCKKKESLLSTRDRLLLDKIK
SYYENAEHHDAGFSVRRRESLSYIPKGLVRNSVSRFNAPPRPDPEPVAPVGHKRQVGSRP
ASWALFDLPGPSQAGPGDPITDAEFRPSSEIVKIWEGMESSRESPQKGPGHGQANGFDLH
EPLLILEEHELGAITEESTTASPESTSPTERPSPAHLARELKELVKELSSNGQGELVAPL
HPRIVQLSHVMDSHVSERVRNKVYQLARQYSLRIKNSKSARPPLPWDKAAPGRDGKTPTV
PCLQEEIGEPSSGKGRRKPVLSLLDYEPSVAQEHSPPKPSSAGEVASRRFAFSPSATSPR
TTSPGGQPSSRSPLSPFDTETFNWPDVRELCSKYASHDRPVGAGGSRPRGLPVNRSRSLP
ENMVEPPLLGRGDLSTRRGLGGRAAAQPPGATPHMGPDGGEALFVTADLILEDNQRVIVL
EKGPLPGPTVGLKEEGSGQGPSSLATPIVQGLDFQVSVERRPKEEGSRDPTDPSQQGRVR
NLREKFQALNSIG
Download sequence
Identical sequences H0WLE7
ENSOGAP00000002464 ENSOGAP00000002464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]