SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002484 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002484
Domain Number 1 Region: 278-465
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-44
Family cAMP-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 28-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-31
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002484   Gene: ENSOGAG00000002772   Transcript: ENSOGAT00000002774
Sequence length 575
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:34824553:34829713:1 gene:ENSOGAG00000002772 transcript:ENSOGAT00000002774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDSKVKTTESSPPAPSKVRKWLPVLDPSGDYYYWWLNTMVFPVMYNLIIVVCRACFPD
LQHGYLVAWMVLDYTSDLLYLLDIIVRFHTGFLEQGILVVDKSRIARRYVNTWSFLLDLV
SLMPTDVAYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSQYVGFGRDVWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEFLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLHHVNRRLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTVMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEDLAEADDEGDSGEGTSKDREGRVSQEGPPGPE
Download sequence
Identical sequences H0WLG0
ENSOGAP00000002484 ENSOGAP00000002484 XP_003781077.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]