SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002520 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002520
Domain Number 1 Region: 546-578,718-792
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000804
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000002520
Domain Number - Region: 223-296
Classification Level Classification E-value
Superfamily Thiolase-like 0.0432
Family Thiolase-related 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002520   Gene: ENSOGAG00000002813   Transcript: ENSOGAT00000002816
Sequence length 982
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:6676488:6745689:-1 gene:ENSOGAG00000002813 transcript:ENSOGAT00000002816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQLERSTISGLSSKNRQSSFVYDVKRDVYNEETFQQEHKRKASSSGTMDIDITTFRHHV
KCRCSWRKFLRCMFTVFPFLEWVCIYRFKDWLLGDLLAGLSVGLVQVSQGLTLSLLTRQL
IPPLNVTYAAFCSSVIYAIFGSCHQMSIGSFFLLSALMINVLKVSPFNNGHLILGTFIKE
DFSVPYYFTGYNKSLNVVATTTFLTGIIQLLMGMMGLGLVTTYLPEAAISAYLAATALHV
ILSQLTFVFGVMISFHSGPIAFFYNIMNYCLALPKANSTSILLFLTAVVALRINKCIRIS
FNRYPIEFPMELFLILGFTALANRISMATETSHTLIDMIPYSFLFPVKPDFSILPRIIFQ
ALSLSFVSSFLLIFLGKKISSLHNYRVSSNQDLLTIGLCNVASSFFRSFVFTGAIARTII
QDKSGGRQQFASLVGSGLMLLLMVKTGHFFYHLPNAVLAGIILSNVLPYLETIYTLPSLW
RKDQYDCAVWIVTFLSAIFLGLDVGLLISLTFAFFIVAVRSHRTKILLLGQIPNTNIYRS
VEDYREIITIPGVKIFQCCNSVTFVNVYHLKHKLLKEVGMVKIPIKEEEIYALFNESDTT
LQEHKICRCSCECDEQEAPARIVYTEQYVQRPDNDSSSFKLIHCSRFSSGNTSQSESSVQ
VPQMLSSVSQRSQGKSFDNEDQVWFQKESNRKSFLQLPNSDENQERSRSLIQYSDESQHP
STHTIILDFTMVHYVDPWALVILRQMCNAFYNANILVLIAGCHSSVVRELERNDFFDAGI
TKAQLFLSIHDAVLFALSRKFLEPSDLSLDESETVIQETYSESDKIDNLIPNMNSSLLES
PRNVNPGFTKTQAPVEEEEESDLDLQVEQEESGLDLDLNLDQELEAESELEFESELEPET
EAEQNPEPETEPQTETETDLELEPRARSKSRAHSLSQWQYWPMFQNTAPTSQSQVPPRTR
SAGRRHRFMDSYSSEGNINQNL
Download sequence
Identical sequences H0WLI6
ENSOGAP00000002520 ENSOGAP00000002520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]