SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002528 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002528
Domain Number 1 Region: 233-348
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-34
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 2 Region: 933-1039
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 1450-1570
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-32
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 4 Region: 1277-1397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-32
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 5 Region: 70-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-32
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 6 Region: 1621-1740
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-30
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 7 Region: 752-873
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-29
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 8 Region: 1808-1911
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 9 Region: 592-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 10 Region: 412-521
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 11 Region: 1100-1215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-22
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 12 Region: 2161-2229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 13 Region: 2218-2287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 2401-2469
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-18
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 15 Region: 2458-2528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2579-2648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.05e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2276-2349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2333-2395
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 2637-2694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 20 Region: 1975-2042
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 21 Region: 2699-2767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000418
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 872-936
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000876
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 23 Region: 9-70
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000101
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 2517-2576
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000107
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 25 Region: 179-247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 697-766
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000334
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 27 Region: 1568-1637
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000389
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 2101-2165
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 29 Region: 1046-1111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 354-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 1222-1285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 32 Region: 1396-1460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 1739-1803
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000216
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 1914-1986
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000027
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 35 Region: 526-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000405
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 36 Region: 2057-2113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000025
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 37 Region: 2758-2815
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002528   Gene: ENSOGAG00000002818   Transcript: ENSOGAT00000002826
Sequence length 3048
Comment pep:known_by_projection scaffold:OtoGar3:GL873633.1:3136048:3518400:1 gene:ENSOGAG00000002818 transcript:ENSOGAT00000002826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSEIEKGGCGDPGVPAYGKRTGSSFLHGDTLTFECQAAFELVGERVITCQQNNQWSGNKP
SCVFSCFFNFTAASGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFL
AVKDDGISDITVLGTFSGNEVPSQLASSGHVVRLEFQSDHSTTGRGFNITYTTFGQNECH
DPGIPVNGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPC
GGHLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGP
ASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSNVGFLIHYESVTLESDSCLDPGI
PVNGHRHGSNFGIRSTVTFSCDPGYTLSDNEPLLCERNHQWNHALPSCDALCGGYIHGKS
GTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFSEPVAR
LTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLESCDDPGVPAFSRRIG
FHFGVGDALTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSP
DFPSNYDNNHECIYKIETEAGQGIHLRARSFQLVEGDILKVYDGKDSSSRLLGTFTKNEL
MGLTLNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFTDT
VVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCVAECGGRIHAATSGRILSPGYPAPY
DNNLHCTWIIEADAGKTISLHFIVFDTETAHDILKVWDGPVDSNILLKEWSGSALPEDTH
STFNSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGMPPNGTRYGDSREAGDTITFQCD
PGYQLQGQAKITCVQLNSRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECD
WKIKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESSGNSLF
LAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSGYKVVD
PSSIMCVIGADGKPSWNRALPSCHAPCGGQYTGSEGVVLSPNYPHNYTAGQVCLYSITVP
KEFVVFGQFAYFQTALNDLAELFDGTHVQARLLSSLSGSHSGETLPLATSNQILLRFSAK
SGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTA
LLCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKITVTEGS
GIQIQVISFATEQNWDSLEIHDGGDAAAPRLGSFSGTTVPALLNSTSNQLYLRFQSDISV
AAAGFHLEYKTVGLAACQEPTVPSNGIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPG
TVRRWNYPSPLCIATCGGTLTSTQGVILSPGFPGSYPNNLDCTWSISLPVGYGAHIQFLN
FSTEANHDYLEIQNGPYHTSPTIGQFSGADLPAALLSTTHETRIHFYSDHSQNRQGFKLA
YQAYELQNCPEPPPFQNGYRINSDYSVGQSVSFECYPGYILIGQPVLTCQHGTNRNWNHP
FPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCVWLITVPPGHGIYINFTLLQTEAVND
YIAVWDGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKC
PPPPAVPQAEMLREDDDFEIGDFVQYQCHPGYTLVGTDTLTCKLSAQLQFEGSLPTCEAQ
CPANEVRTESSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVF
DGSSGQSPLLVVLSGNHTEQSNFTSKSNQLYLRWSTDHATSKKGFKIRYAAPYCSLALSL
KDGGIVNRTAGAVGSQVHYFCKPGYRLIGHSNASCRRNPLGTYQWDALPPLCQAVSCGIP
ESPGNGSFTGNEFTLDGKVTYECNEGFKLDASQPATAVCQEDGLWSNKGRPPTCKPVPCP
SVEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYYLEGQRLIQCQANGTWSVEDERPSCK
VISCGSLPFPPNGNKIGTLKVYGATAIFTCNTGYTLVGSHVRECLANGLWSGMETRCLAG
HCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVSITC
GHPGNPAHGSTNGSEFNLNDVVNFTCHTGYLLQGASRAQCRSNGQWSSPLPTCRVVNCSD
PGFVENAIRPGQQNFPKSFEYGMSVLYHCKKGFYLLGSSALTCTANGLWDRSLPKCLAIS
CGHPGVPANAILTGELFTYGATVHYSCKGGHSLVGNNSRVCQEDSHWSGTLPHCTGNDPG
FCGDPGTPAHGSRLGDEFKVKNLLRFSCEVGYQLRGSPERTCLLNGSWSGLQPECEAVSC
GNPGTPTNGMIVSSDGVLFSSSVIYACWEGYHTSGLMTRHCTANGTWTGTAPDCTIISCG
DPGTLANGIQFGADFTFNKTVSYQCDPGYLLEPATAATIRCTKDSTWNQSKPVCKEIAVL
CPQPPHVQNGKVEGTDFHWGSSISYSCADGYQVSHAAILSCEGQGVWKGEVPQCLPVFCG
DPGTPAEGRLSGKSFTYKSEVFFQCKPPFILVGSSRRICQADGSWSGIQPTCIDPAHNTC
PDPGTPHFGVQNSSRGYEVGSTVFFRCRKGYHVQGSTTRTCLANLTWSGIQTECIPHACR
QPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVR
EVNETVTKTPVPSDVFFINSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFTGSSPAE
LRLTGVYKKEEAHLLLKAFQSKGPVDIFVSKFENDNWGLDGYVSSGFERGGFTFQGDIHG
KDFGKFKLERQDPLNSDQDSSHHHHGTSSGSVAAAILVPFFALILSGFAFYLYKHRTRPK
VQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences H0WLJ2
ENSOGAP00000002528 ENSOGAP00000002528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]