SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002607 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002607
Domain Number 1 Region: 322-392
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.1e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002607   Gene: ENSOGAG00000002910   Transcript: ENSOGAT00000002914
Sequence length 1153
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:596244:618036:-1 gene:ENSOGAG00000002910 transcript:ENSOGAT00000002914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEQPFSEVALEQALAEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGDGAGGID
PASPDASSPGSLSPPPTTLSSPLEGFMGGPKAALSPLSPPQSTPTPLKMYPSMPTFPPEP
GIKEESVPLSILQTPTPQPLPGALLSQSFPGPVPLQFSSAPVLSYPSPPGAFSTGTPPVS
SPQPLPSLPLASPPGVPPVSLHTQVQSTAPQQLLTATAAPTASPGTTTVASQIQQVPVLL
QPHFIKADSLLLTAMKTDVGATVKAAGLSPLVPGTAVQTGPLQTLVSGGTILTTVPLVVD
ADKLPINRLAGGSSKAPGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGAEAKLN
KSAVLRKAIDYIRFLQHSNQKLKQENLSLRAAAQKSKSLKDLVSTYGSGGNTDVLMEGVK
TEVEDTLTPPPSDAGSPSQSSPLSLGSRGSGSGGSGSDSEPESPVFEDNQPACPYQVQPE
QSRGMLDRSRLALCTLVFLCLSCNPLASLLGGWEVPDPSDATSVYHSPGRNMLGTEGRDG
PSWAQWLLPPLVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVDFWRHRKQADLDLARGD
FAQATQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQRDCA
LQADVRASTRDAALVYHKLHQLHTMGKYTGGHFTATNLALSALNLAECAGDAMSVVTLAE
IYVAVALRVKTSLPRSLHFLTRFFLSSARQACLAQSGSVPLAMQWLCHPMGHRFFVDGDW
AVRSAPRESLYSLAGNTVDPLAQVTQLFREHLLEQALNCMAQPSPSPGSADGDSREFSDA
LGYLQLLNSCCDAANTPACSLPINSSMATNMGTDPVAKWWASLTAVVIHWLRRDEEAAER
LYPLVEHLPRALQESERPLPRAALHSFKAARALLGCAKAESAPASLTICEKASGYLRDSL
ATTPIGSSIDKAVQLFLCDLLLVVRTSLWRQQQPPTPTQMSQGTNGGMQASALELRGFQR
DLSGLRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGLGSKGGPAVV
SELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQM
LMRLGGGTTVTSS
Download sequence
Identical sequences H0WLQ4
ENSOGAP00000002607 ENSOGAP00000002607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]