SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002624 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002624
Domain Number 1 Region: 810-918
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-22
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 280-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.13e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 29-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 626-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000393
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 5 Region: 242-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 162-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000325
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 203-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000692
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002624   Gene: ENSOGAG00000002933   Transcript: ENSOGAT00000002935
Sequence length 995
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:5923320:5960639:1 gene:ENSOGAG00000002933 transcript:ENSOGAT00000002935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRVPGLCLFVLLVHARAAQHSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKATDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAE
GNGGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKG
GIACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHVKFVLHTDGKTCIE
TCAVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGS
FECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLYGVTHCGDV
DECSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPVKCQGSPGALKAMLSCNR
SGKKDTCALTCPSRARFSPESENGFTVSCGIPSPRAAPPRASHTGNNTSSNHCHEAAVLS
IKQRASFKIKDAKCRLHLRNKGKMEEAGKIPGPGGTPCSDCHVTFIHLKCDSSRKGKGRR
ARTPPGKEVTRLTLELEAEVRTEETTAACGLPCLRQRMERRLKGSLKMLRKSINQDRFLL
RLAGLDYELAHKPGLVAGERTELVESCRPGQHRAGAKCVSCPQGTYYHGQTEQCVPCPAG
TFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGHHSVDGFKPCQPCPRGTYQPEA
GRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNF
CTRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPP
KRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINF
KTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAH
PQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences H0WLR8
ENSOGAP00000002624 ENSOGAP00000002624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]