SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002633 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002633
Domain Number 1 Region: 118-325
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.65e-24
Family Nuclease 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002633   Gene: ENSOGAG00000002938   Transcript: ENSOGAT00000002944
Sequence length 825
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:1279329:1310628:-1 gene:ENSOGAG00000002938 transcript:ENSOGAT00000002944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSQVQCLDDNHVNWRSSESKPEFFYSEGQRLALEALVARGRDAFYEVLKQENIRDFLS
ELELKRILESIEVYDPGSEDPRGTGPCQGPEDNRLGLGNGEEASGAGGAPTEAEPLPSLE
YWPQKSDRSIPQLDLGWPDTIAYRGVTRASVYMQPPIDGQAHIKEVVRKMISQAQKVIAV
VMDMFTDVDIFKDLLDAGFKRKVAVYIIVDQNNIKHFLHMCGRARMHLGHLKNLRVRSSG
GTEFFTRSATKFKGVLAQKFMFVDGDRAVCGSYSFTWSAARTDRNVISVLSGQVVEVFDR
QFQELYLMSHGISLKDIPMEKEPEPEPIVLPSVVPLVPTGTTAKKLVNPKYALVKAKSAE
EIAKTSSDKQEAKRPTGLRGAALAEGLGDLPEPPPIHPGLLHLERADMFEYLPTWVEPDP
EPGSDILGYINIIDPNIWNPQPSQMNRIKIRDTSQASAQHQLWRQSQDHSTHPEPHPTSG
PSALQDNIAVQNGLPQRDPEPLTPVPKPRTVPVADLLAQDDSSVGWALETASEEIPQNGT
GHGLPRMAGSGHPPLQRQLSVTRDDPDGLGAGIPNGLDGEEEEDDDDYVTLSDQDSLSGS
SSRGPGPWQPSAASSPMSDEYFEVREHSAPLRRRHSEQVANGPAQPPRRQLSAPHITRGT
FGGPLGGSLWAQGRGREEVDVPRKMQAQRPSDKEEQGQRFHHCRVPASGTRGKDGFRGAL
QFRSAGNGAQSSTRKAGPASAGPHHWQAKSGPVPRVLSGPASPRLARNARPLADGPATEE
HPSPLGIPYSKLSQSKHLKARTGGSQWGSSDSKRRAPAPQDRKDP
Download sequence
Identical sequences H0WLS5
ENSOGAP00000002633 ENSOGAP00000002633 XP_012661406.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]